Sale!

weareproudoftakingcareofeverycustomerweserveasiftheywerefamilymemberswehelppeoplefindthetamaleladysfmenstankstrikeforce0.jpg

weareproudoftakingcareofeverycustomerweserveasiftheywerefamilymemberswehelppeoplefindthetamaleladysfmenstankstrikeforce1.jpg

TAMALE LADY SF MEN’S TANK strikeforce

Name: We are proud of taking care of every customer we serve as if they were family members. We help people find the TAMALE LADY SF MEN'S TANK strikeforce
SKU: mode_1661384949871
Price: 18.00 USD
Availability: InStock

$ 18,00

Size

Color

Substrate

Clear

SKU: mode_1661384949871 Category: Mens - Sleeveless Tags: Sleeveless, UCO0162, UP Corp

$10 from every item purchased will go directly to the Tamale Lady’s Go Fund Me campaign, established to cover the costs of her memorial and funeral service.

For over 20 years, Upper Playground has hosted both established and emerging artists. Sometimes they contribute art under their own name, and other times under ours. Whether they are a graffiti artist, a fine artist, a production artist, an illustrator, a photographer or an intern, they’re all presented as equals under the banner of Upper Playground.

product_details_separator

Our Sleeveless t-shirts are good for guys with muscular arms, but they’re WAY cooler on guys who can barely curl a coffee cup. The fabric is mid-weight and the body cut is a semi-fitted. Solid colors feature a softer, 100% combed ringspun cotton. Heather colors feature a 50/50 cotton/poly blend.

Our designs are printed using all-natural, environmentally friendly, water-based and metal-free inks. Vinegar is used as a curing agent and helps ensure that the design will last a long time without fading. Any odor it leaves behind will fade significantly when left out, and will be gone entirely once the item is washed.

To best preserve the life of the design, we recommend washing our apparel inside out, in cold or lukewarm water, gentle cycle and either tumble drying low or line drying

Size	SM, MD, LG, XL, 2X, 3X
Color	Athletic Heather, White
Substrate	AS5307

Fast Shipping with Professional Packaging

Thanks to our longstanding association with UPS FedEx DHL and other top global carriers, we can provide a range of shipping options. Our warehouse staff are trained to pack your goods exactly as per the specifications we provide. Your products will be subjected to a thorough examination and will be properly packaged prior to being shipped. Everyday, we send to thousands of customers in many countries. This shows how we're dedicated to be the largest retailer online in the world. There are distribution centers and warehouses across Europe and the USA.

Note that orders containing more than one item will be subject to a processing period that is based to the specific item.

Prior to shipment We will inspect thoroughly the items you've ordered. Most orders are delivered within 48 hours. Expected delivery time is between 3 and 7 days.

Returns

The stock is constantly changing and not fully managed by us due to the involvement of multiple entities, including the factory as well as our warehouse. Actual stock levels may fluctuate at any moment. It's possible that your order may become unfulfilled after you place the order.

Our policy is valid for 30 days. If it's been more than 30 days since you bought the item and we're unable to offer you a complete refund or exchange.

The item cannot be in use and must be in the original packaging. It must also be returned in the original packaging.

TAMALE LADY SF MEN’S TANK strikeforce

Related products

Login